Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAKKGMINRELKREKTVAKYAVKRAELKATIANVNASDEERFEAMLKLQALPRNASPVRLRNRCGLTGRPHGYFRKFGLSRNKLRDTVMQGDVPGVVKASW
4A2I Chain:N ((1-100))-AKQSMKAREVKRVALADKYFAKRAELKAIISDVNA----RWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW


General information:
TITO was launched using:
RESULT:

Template: 4A2I.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain N - contact count / total energy / energy per contact / energy per residue : 253 1411 5.58 14.70
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain N : 0.87

3D Compatibility (PKB) : 5.58
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.87
QMean score : 0.444

(partial model without unconserved sides chains):
PDB file : Tito_4A2I.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4A2I-query.scw
PDB file : Tito_Scwrl_4A2I.pdb: