Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMPNIESAIKRVRTSENANVKNSSQTSAMRTAIKKFEDAVASGADNVDA--LYKEAVKAIDMAESKGLIHKNKANRDKSRLSKKIAK
4ADV Chain:T ((2-84))--NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAG-DKAAAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINK


General information:
TITO was launched using:
RESULT:

Template: 4ADV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 184 23754 129.10 293.26
target 2D structure prediction score : 0.52
Monomeric hydrophicity matching model chain T : 0.80

3D Compatibility (PKB) : 129.10
2D Compatibility (Sec. Struct. Predict.) : 0.52
1D Compatibility (Hydrophobicity) : 0.80
QMean score : 0.611

(partial model without unconserved sides chains):
PDB file : Tito_4ADV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4ADV-query.scw
PDB file : Tito_Scwrl_4ADV.pdb: