Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GCPYSIKRYGEEVKWDIIEAGTSHIRVVNGIGATIIAKKNCKLSLKGLPRFEYTISRGDSINRQS 7REQ Chain:A ((401-442)) --PWSGSAYVEELTWDLARKAWGHIQEVEKVGGMAKAIE------KGIPK---------------

General information: TITO was launched using: RESULT: Template: 7REQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 40 -2440 -60.99 -58.08 target 2D structure prediction score : 0.24 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -60.99 2D Compatibility (Sec. Struct. Predict.) : 0.24 1D Compatibility (Hydrophobicity) : 0.71 QMean score : -0.041

(partial model without unconserved sides chains): PDB file : Tito_7REQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-7REQ-query.scw PDB file : Tito_Scwrl_7REQ.pdb: