Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence AILGFVNKQQAHDLLINKPDGTFLLRFSD-SEIGGITIAW--KLDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVF 1BG1 Chain:A ((459-539)) -IMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGSTQIQSVEPYTKQQLNNMSFAE------------

General information: TITO was launched using: RESULT: Template: 1BG1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 206 -5899 -28.63 -90.75 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -28.63 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.555

(partial model without unconserved sides chains): PDB file : Tito_1BG1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1BG1-query.scw PDB file : Tito_Scwrl_1BG1.pdb: