Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHY 5IBM Chain:A ((113-219)) WFHGHLSGKEAEKLLTEKGKHGSFLVRES--HPGDFVLSVRTG---------KSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHY

General information: TITO was launched using: RESULT: Template: 5IBM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 283 -42296 -149.46 -563.95 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.98 3D Compatibility (PKB) : -149.46 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.98 QMean score : 0.880

(partial model without unconserved sides chains): PDB file : Tito_5IBM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5IBM-query.scw PDB file : Tito_Scwrl_5IBM.pdb: