Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHF 2PLD Chain:A ((11-84)) WYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNS-YAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYY

General information: TITO was launched using: RESULT: Template: 2PLD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 241 -32925 -136.62 -444.93 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.79 3D Compatibility (PKB) : -136.62 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.508

(partial model without unconserved sides chains): PDB file : Tito_2PLD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2PLD-query.scw PDB file : Tito_Scwrl_2PLD.pdb: