Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQS--QYYLAARNCLVND 2EU0 Chain:A ((8-78)) WYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEK------

General information: TITO was launched using: RESULT: Template: 2EU0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 277 -12471 -45.02 -180.73 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.83 3D Compatibility (PKB) : -45.02 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.562

(partial model without unconserved sides chains): PDB file : Tito_2EU0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2EU0-query.scw PDB file : Tito_Scwrl_2EU0.pdb: