Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKTYHRDGKYGFSDPLTFNSVVELINHY 4L1B Chain:B ((42-117)) WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY

General information: TITO was launched using: RESULT: Template: 4L1B.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 264 -26556 -100.59 -349.42 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain B : 0.98 3D Compatibility (PKB) : -100.59 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.98 QMean score : 0.872

(partial model without unconserved sides chains): PDB file : Tito_4L1B.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4L1B-query.scw PDB file : Tito_Scwrl_4L1B.pdb: