Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHY
1H9O Chain:A ((12-86))WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHY


General information:
TITO was launched using:
RESULT:

Template: 1H9O.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 281 -46387 -165.08 -618.49
target 2D structure prediction score : 0.76
Monomeric hydrophicity matching model chain A : 0.90

3D Compatibility (PKB) : -165.08
2D Compatibility (Sec. Struct. Predict.) : 0.76
1D Compatibility (Hydrophobicity) : 0.90
QMean score : 0.749

(partial model without unconserved sides chains):
PDB file : Tito_1H9O.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1H9O-query.scw
PDB file : Tito_Scwrl_1H9O.pdb: