Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence REKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHY 4WAF Chain:B ((51-120)) -EKLRDTADGTFLVRDAST----DYTLTLRKGGNNKLIKIF-------FSDPLTFSSVVELINHY

General information: TITO was launched using: RESULT: Template: 4WAF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 147 -25714 -174.92 -485.16 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain B : 0.95 3D Compatibility (PKB) : -174.92 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.95 QMean score : 0.828

(partial model without unconserved sides chains): PDB file : Tito_4WAF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WAF-query.scw PDB file : Tito_Scwrl_4WAF.pdb: