Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHL-GGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDY 4E68 Chain:A ((454-544)) WNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGSTQIQSVEPYTKQQLNNMSFAEIIMGY

General information: TITO was launched using: RESULT: Template: 4E68.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 238 -12905 -54.22 -167.59 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain A : 0.87 3D Compatibility (PKB) : -54.22 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.87 QMean score : 0.645

(partial model without unconserved sides chains): PDB file : Tito_4E68.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4E68-query.scw PDB file : Tito_Scwrl_4E68.pdb: