Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIQIIVNTFIEKDKTGAVVEVLYASADQDKVQAKYEELAAQYPENYLAIYDVPLDTDLNTLDHYPSVFIEKEEFE 5J72 Chain:A ((11-49)) -------------------SVVLGSKSNASVKFK-EKLNADSITLNFMCYDMPLEATLN----------------

General information: TITO was launched using: RESULT: Template: 5J72.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 51 -4903 -96.14 -125.72 target 2D structure prediction score : 0.18 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -96.14 2D Compatibility (Sec. Struct. Predict.) : 0.18 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.077

(partial model without unconserved sides chains): PDB file : Tito_5J72.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5J72-query.scw PDB file : Tito_Scwrl_5J72.pdb: