Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTEIAAEFNCPPTTIHYALKAMGYSLKKSRTYCEQDPEKVNRFLKELNHLSYLTPIYIYETGVETYFYLEYDRALSRQLVSLEEDIII 4RK4 Chain:A ((31-66)) --------------IERELHAHGYQVMITQTY--DDPEAEERFLKQL-----------------------------------------

General information: TITO was launched using: RESULT: Template: 4RK4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 33 900 27.27 29.03 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : 27.27 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.710

(partial model without unconserved sides chains): PDB file : Tito_4RK4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4RK4-query.scw PDB file : Tito_Scwrl_4RK4.pdb: