Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLKKEKKMAEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKMGKGITLSNEEFQTMVDAFKGN 2LTT Chain:A ((5-66)) -----------LKFEIIEELIVLSENAKGWRKELNRVSWNDAEPKYDIRTWSPDHEKMGKGITLSEEEFGVLL------

General information: TITO was launched using: RESULT: Template: 2LTT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 210 202 0.96 3.25 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.86 3D Compatibility (PKB) : 0.96 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.86 QMean score : 0.473

(partial model without unconserved sides chains): PDB file : Tito_2LTT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LTT-query.scw PDB file : Tito_Scwrl_2LTT.pdb: