Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTRYALLVRGINVGGKNKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIF 2ZW7 Chain:A ((110-161)) ----------------TEAAAAVVGHALEDGGLDRVEAWIEAGNRRSLAVAARVGLTERAR--LAQHYPH------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2ZW7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 100 -11160 -111.60 -214.62 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -111.60 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.290

(partial model without unconserved sides chains): PDB file : Tito_2ZW7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZW7-query.scw PDB file : Tito_Scwrl_2ZW7.pdb: