Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKILKRYILELCFILSFALPFIKGANADNGRCFVETYYGFTFLMEHAIVTAVFIYSFLIAFLLKKRWAKWIAAGSYCFLVLWIAAGSYCFLVLWIATEGYFFRMSLEDLIRLWTSLEILTQTYQLGFYLNILLGILLIIKYFKVKQ 4CRY Chain:G ((22-34)) -----------------------IWNVTNGKRF-SVY-------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4CRY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 12 -667 -55.54 -51.27 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain G : 0.34 3D Compatibility (PKB) : -55.54 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.34 QMean score : 0.925

(partial model without unconserved sides chains): PDB file : Tito_4CRY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4CRY-query.scw PDB file : Tito_Scwrl_4CRY.pdb: