Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSWTFDNKKPIYLQIMEKIKLQIVSHTLEPNQQLPTVRELASEAGVNPNTIQRALSDLEREGFVYSKRTTGRFVTKDKELIAQSRKQLSEEELEHFVSSMTHFGYEKEELPGVVSDYIKGV 2WV0 Chain:A ((10-78)) ---------PIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRGTFVSKPK-------------------------------------------

General information: TITO was launched using: RESULT: Template: 2WV0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 226 -32989 -145.97 -478.10 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -145.97 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.822

(partial model without unconserved sides chains): PDB file : Tito_2WV0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2WV0-query.scw PDB file : Tito_Scwrl_2WV0.pdb: