Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MREYRTYEEITADFGIHESNLIRRSQWVEVTLVQSGVTISKTHLSAENTVIVDATEVKINRPKKIN 2PE5 Chain:B ((3-27)) ----VTLYDVAEYAGVSYQTVSRVVNQAS-------------------------------------

General information: TITO was launched using: RESULT: Template: 2PE5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 46 -5630 -122.39 -225.20 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : -122.39 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.695

(partial model without unconserved sides chains): PDB file : Tito_2PE5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2PE5-query.scw PDB file : Tito_Scwrl_2PE5.pdb: