Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLEIWKYRPFVSEFWNDFKNNHDKQFVDPISLYLTLKDDDDPRIEEES-EALENMILQYLGEDDAS 1H83 Chain:A ((332-373)) --------------WQEF----EKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVL------

General information: TITO was launched using: RESULT: Template: 1H83.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 57 -7084 -124.27 -172.77 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.75 3D Compatibility (PKB) : -124.27 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.690

(partial model without unconserved sides chains): PDB file : Tito_1H83.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1H83-query.scw PDB file : Tito_Scwrl_1H83.pdb: