Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKLLDKILSRENMLEAYNQVKSNKGSAGIDGMTIEEMDNYLRQNWRLTKELIKQRKYKPQPVLRVEIPKPDGG-IRQLGIPTVMDRMIQQAIV 5G2X Chain:C ((39-216)) ----------------AYQNLYSNKG-ASTKGILDDTADGFSEEKIKKIIQSLKDGTYYPQPVRRMYIAKKNSKKMRPLGIPTFTDKLIQEAV-

General information: TITO was launched using: RESULT: Template: 5G2X.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 152 8071 53.10 107.61 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain C : 0.75 3D Compatibility (PKB) : 53.10 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.129

(partial model without unconserved sides chains): PDB file : Tito_5G2X.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5G2X-query.scw PDB file : Tito_Scwrl_5G2X.pdb: