Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKTNIILAVLIGLIVGGVIGAFGYAKTAAKYDAISTACVMMNEAVENNLLTVEQVKTLGELTGTNMKKDYPTVASKFAFSPENLKNASEASNCSQFIVGFNQSK 4P1A Chain:A ((15-42)) ----KILIGLILGAIVGLILGHYGYAHAVHTY-------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4P1A.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 26 -4179 -160.73 -149.25 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -160.73 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.467

(partial model without unconserved sides chains): PDB file : Tito_4P1A.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4P1A-query.scw PDB file : Tito_Scwrl_4P1A.pdb: