Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLIHYPVYFFFELIQASCNEYIASGSNKEDIMLLNRKHSLVSCFDLELLETHPVKIKNSKVKQKNFITVSLEFSFKKIPPIF 3CJL Chain:B ((59-76)) ----------------------------GEVMMQQRKHPLFKEFSA------------------------------------

General information: TITO was launched using: RESULT: Template: 3CJL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 19 -1747 -91.95 -97.06 target 2D structure prediction score : 0.28 Monomeric hydrophicity matching model chain B : 0.53 3D Compatibility (PKB) : -91.95 2D Compatibility (Sec. Struct. Predict.) : 0.28 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.424

(partial model without unconserved sides chains): PDB file : Tito_3CJL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3CJL-query.scw PDB file : Tito_Scwrl_3CJL.pdb: