Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLIYKVYLNIISLHWGRTDMNLSYLKTSLYTAATTAILLCSSQSQAQQYYKWMDKSGSTHYTTTPPPKGAKHLNKVSTYGSQPLLKNPTSNSEQPSQDKDKVVQEVTNVAVEKGAPAVPVPPAPSVSAPR 4YTB Chain:A ((160-198)) ----------------------------------------SSLSQAQVNQKMKDYLGITHHDVVQDPNG-EYINHVDCWG--------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4YTB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 57 3000 52.62 76.91 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : 52.62 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.649

(partial model without unconserved sides chains): PDB file : Tito_4YTB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4YTB-query.scw PDB file : Tito_Scwrl_4YTB.pdb: