Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQQLMIMVTEVGKLEHTCNLLAEVNKGGKVIKVFDYNGNELSMNMDGIVTFNRKRWELPVKVDLK 2ATZ Chain:A ((46-82)) -TSSLIQKHLKREIEIAHNLILRNDKVENI--VFDYNGRN-------------------------

General information: TITO was launched using: RESULT: Template: 2ATZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 27 -4068 -150.65 -109.93 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -150.65 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.255

(partial model without unconserved sides chains): PDB file : Tito_2ATZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ATZ-query.scw PDB file : Tito_Scwrl_2ATZ.pdb: