Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKSELIDAIAEKGGVSKTDAGKALDATIASITEALKKGDTVTLVGFGTFSVKERAARTGRNPKTGEELQIKATKVPSFKAGKGLKDSVA 4YEW Chain:A ((1-89)) MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKE-------------------AKVPSFRAGKALKDAV-

General information: TITO was launched using: RESULT: Template: 4YEW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 165 -13047 -79.07 -186.38 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.89 3D Compatibility (PKB) : -79.07 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.89 QMean score : 0.607

(partial model without unconserved sides chains): PDB file : Tito_4YEW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4YEW-query.scw PDB file : Tito_Scwrl_4YEW.pdb: