Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------MWYFAWILGILMACFAGVLSALYIEHHQNLDEE 2JWA Chain:A ((41-84)) GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK

General information: TITO was launched using: RESULT: Template: 2JWA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 5 -1813 -362.60 -54.94 target 2D structure prediction score : 0.94 Monomeric hydrophicity matching model chain A : 0.77 3D Compatibility (PKB) : -362.60 2D Compatibility (Sec. Struct. Predict.) : 0.94 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.124

(partial model without unconserved sides chains): PDB file : Tito_2JWA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JWA-query.scw PDB file : Tito_Scwrl_2JWA.pdb: