Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MANQTPQAMRRIPVSDIEQRVKKAVAEQLGLKAEEIKNEASFMDDLGADSLDLVELVMSFENDFDITIPDEDSNEITTVQSAIDYVTKKLG 4IHF Chain:G ((3-75)) -------------MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYI-----

General information: TITO was launched using: RESULT: Template: 4IHF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 253 -32524 -128.55 -445.53 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain G : 0.88 3D Compatibility (PKB) : -128.55 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.88 QMean score : 0.643

(partial model without unconserved sides chains): PDB file : Tito_4IHF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IHF-query.scw PDB file : Tito_Scwrl_4IHF.pdb: