Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNLLLSI-AQLAKSTYYYWVKKLDKPDKYSKIKQEITAIVKESRNSYGYRRVTLALKMKGYTINHKTVRKLMSQMGLTCQIRIKRYKSYKGTVGKIAKNVLKRNFSVDTPNKKWVTDVTEFKIKGRKIYLSPYT 3IFE Chain:A ((290-351)) ---LLSLNGDVEQSKAYYIIRDFDRKN-FEARKNTIENIVKQMQEKYGQDAVVLEMNDQYYNMLEK--------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3IFE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 94 3644 38.77 59.74 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 38.77 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.250

(partial model without unconserved sides chains): PDB file : Tito_3IFE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IFE-query.scw PDB file : Tito_Scwrl_3IFE.pdb: