Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MALSYGNKKWSLDEAEIPTYEDTWHLRVEVKEEAENIGGCTLFGKGFGNYDQDIKIKMFYS 1RZH Chain:L ((4-24)) ----------------------------SFERKYRVPGG-TLVGGNLFDF-----------

General information: TITO was launched using: RESULT: Template: 1RZH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 15 1741 116.03 82.88 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain L : 0.61 3D Compatibility (PKB) : 116.03 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.381

(partial model without unconserved sides chains): PDB file : Tito_1RZH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RZH-query.scw PDB file : Tito_Scwrl_1RZH.pdb: