Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLETAIEVLEKCAQLVTASEEWGYESVTMEKEEIEMGMLPEDVTLPRLVMTHLYIYCAPEDGKDYVVYFITDITSQREFVRGLLVEGRLVWSQIGGTNE 5JPN Chain:A ((251-290)) -----------------------------------------------------YIYGKPVQGVAYVRFGLLDEDGKKTFFRGLESQTKLVNGQ------

General information: TITO was launched using: RESULT: Template: 5JPN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 66 -1710 -25.90 -42.74 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -25.90 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.143

(partial model without unconserved sides chains): PDB file : Tito_5JPN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5JPN-query.scw PDB file : Tito_Scwrl_5JPN.pdb: