Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKNASLFSLSISKDSSFLLECQMIGREEKGNFDKKEEVSDFPVNKNRVGKKKRFEEVYGSIFRNLGTKKAPRQCFFEKLMTD 2J2C Chain:A ((26-84)) --------------------------------DRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCF-------

General information: TITO was launched using: RESULT: Template: 2J2C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 32 10 0.31 0.23 target 2D structure prediction score : 0.40 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : 0.31 2D Compatibility (Sec. Struct. Predict.) : 0.40 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.593

(partial model without unconserved sides chains): PDB file : Tito_2J2C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2J2C-query.scw PDB file : Tito_Scwrl_2J2C.pdb: