Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIVKRPKRRISMQFGRFRLGMRTIKSALAVFLCILFFHLTQRGIPMIAALSAVFSLRQDLTTTVSFGKSRIIGNTLGGTLAIIYFFVKSYFHNDFLVELILLPILVIIVIVVSDGINNNSGIISAIATLLLIALSIPQGESALYAIQRVLDTFIGTFIAIGINFFLRPPETEKKEELSEDLVELQKKERLLRTNLQEIEAKIQKQKKNSED 1FXK Chain:B ((60-108)) ------------------------------------------------------------------------------------------------------------------------------------------------------------------NILIRVAKDELTEELQEKLETLQLREKTIERQEERVMKKLQEMQVNIQE

General information: TITO was launched using: RESULT: Template: 1FXK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 6 1307 217.83 26.67 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain B : 0.45 3D Compatibility (PKB) : 217.83 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.45 QMean score : 0.811

(partial model without unconserved sides chains): PDB file : Tito_1FXK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FXK-query.scw PDB file : Tito_Scwrl_1FXK.pdb: