Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKSEKLDHSLLGKQRKTVETVFSSLE-KLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY 1J27 Chain:A ((16-40)) --------ARSLKEKRALIKPALERLKARFPVS------------------------------------------

General information: TITO was launched using: RESULT: Template: 1J27.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 13 1859 142.96 77.44 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : 142.96 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.636

(partial model without unconserved sides chains): PDB file : Tito_1J27.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1J27-query.scw PDB file : Tito_Scwrl_1J27.pdb: