Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMCTAITYATKD--HYFGRNFDYEMSYNEVVTITPRNYR-FDFRKVKNLDKHYAMIGIAAGVSNYPLYYEATNEKGLSMAGLNFPGNADY-KELQEGKDNVAPFEFIPWILGQCSTIDEAKELLATINLVNIDFSEKLPLSPLHWLLAD-KEKSIVIESMKDGLHLYDNPVGVLTNNPPFDYQLFNLNNYRSLSNGTRV
2RF8 Chain:A ((2-192))-ATGLALETKDGLHLFGRNMDIEYSFNQSIIFIPRNFKCVNKSNKKELTTKYAVLGMGTIFDDYPTFADGMNEKGLGCAGLNFPVYVSYSKEDIEGKTNIPVYNFLLWVLANFSSVEEVKEALKNANIVDIPISENIPNTTLHWMISDITGKSIVVEQTKEKLNVFDNNIGVLTNSPTFDWHVANLNQYVGL------


General information:
TITO was launched using:
RESULT:

Template: 2RF8.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 978 36536 37.36 196.43
target 2D structure prediction score : 0.50
Monomeric hydrophicity matching model chain A : 0.84

3D Compatibility (PKB) : 37.36
2D Compatibility (Sec. Struct. Predict.) : 0.50
1D Compatibility (Hydrophobicity) : 0.84
QMean score : 0.455

(partial model without unconserved sides chains):
PDB file : Tito_2RF8.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2RF8-query.scw
PDB file : Tito_Scwrl_2RF8.pdb: