Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDPIERLNSLSEEVTQTFHSDFVFLIDAEKIQHFPARNWTHDQIIEELKKRFDHSLMVKPWHEHEVIYSPELPVFALIPKK 4BJK Chain:B ((105-142)) ----EQLNFLAEELTIAKFQNFVPAIQHE-VRKFMAANWDKDE--------------------------------------

General information: TITO was launched using: RESULT: Template: 4BJK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 14 -2019 -144.21 -53.13 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain B : 0.64 3D Compatibility (PKB) : -144.21 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.265

(partial model without unconserved sides chains): PDB file : Tito_4BJK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BJK-query.scw PDB file : Tito_Scwrl_4BJK.pdb: