Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPFVRIDLFEGRTLEQKKALAKEVTEAVVRNTGAPQSAVHVIINDMPEGTYFPQGEMRTK 1BJP Chain:B ((1-59)) -PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK

General information: TITO was launched using: RESULT: Template: 1BJP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 154 -19719 -128.05 -334.22 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain B : 0.85 3D Compatibility (PKB) : -128.05 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.751

(partial model without unconserved sides chains): PDB file : Tito_1BJP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1BJP-query.scw PDB file : Tito_Scwrl_1BJP.pdb: