Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKMATDKNRIMISLDDKNLEKLENLVEDVRDRRGMRL-TKSQVIELLLNTVDYFDDIMGAIYSKK 2BJ7 Chain:B ((2-41)) ------ELIRFSISIPSKLLEKFDQIIE----EIG--YENRSEAIRDLIRDF--------------

General information: TITO was launched using: RESULT: Template: 2BJ7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 44 -5589 -127.01 -143.29 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain B : 0.67 3D Compatibility (PKB) : -127.01 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.636

(partial model without unconserved sides chains): PDB file : Tito_2BJ7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2BJ7-query.scw PDB file : Tito_Scwrl_2BJ7.pdb: