Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSIEFVRIDDRLVHGQVVTTWLKKYDIEQVIIVNDRISEDKIRQSILKISAPVGLKIVFFSVKRFVEVLNSVPIKKRTMLIYTNPKDVYDSIEGNLKLEYLNVGQMSKTEENEKVTGGVALGEEDKYYFKKIVDKGTRVEIQMVPNDKVTMLEKFL 3R2C Chain:K ((49-80)) --------------------------FSRILDIIRF--TPQTIEALMEISLPAGVDVEVK------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3R2C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain K - contact count / total energy / energy per contact / energy per residue : 27 -8525 -315.74 -266.41 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain K : 0.54 3D Compatibility (PKB) : -315.74 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.580

(partial model without unconserved sides chains): PDB file : Tito_3R2C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3R2C-query.scw PDB file : Tito_Scwrl_3R2C.pdb: