Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKVKEIRELTTAEMLDQEKQLKEELFNLRFQLATGQLENTARIKEVRKSIARIKTVLREQAK 5O60 Chain:Z ((5-65)) TTPGELRELTDDELKDKLRESKEELFNLRFQMATGQLSNNRRLRTVRQEIARVYTVLRERE-

General information: TITO was launched using: RESULT: Template: 5O60.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain Z - contact count / total energy / energy per contact / energy per residue : 116 -11024 -95.03 -180.72 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain Z : 0.85 3D Compatibility (PKB) : -95.03 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.789

(partial model without unconserved sides chains): PDB file : Tito_5O60.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5O60-query.scw PDB file : Tito_Scwrl_5O60.pdb: