Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceCYHGKLSRKAAESLLVK---DGDFLVRESATSPGQYVLSGLQGGQAKHL-LLVDPEGKVRTKDHVFDNVGHLIRYH
3OV1 Chain:A ((8-83))WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH


General information:
TITO was launched using:
RESULT:

Template: 3OV1.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 246 6214 25.26 86.31
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain A : 0.78

3D Compatibility (PKB) : 25.26
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.78
QMean score : 0.713

(partial model without unconserved sides chains):
PDB file : Tito_3OV1.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3OV1-query.scw
PDB file : Tito_Scwrl_3OV1.pdb: