Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNELVDFY 1TZE Chain:E ((6-81)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 1TZE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 270 -35676 -132.13 -469.42 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain E : 0.91 3D Compatibility (PKB) : -132.13 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.91 QMean score : 0.609

(partial model without unconserved sides chains): PDB file : Tito_1TZE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TZE-query.scw PDB file : Tito_Scwrl_1TZE.pdb: