Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKLIVSVMPRSLEEAQA-LDAT-RYLDADIIEWRADYLPKE----AILQVAPAIFEK-FAGRELVFTLRTRSEGGEIDLSPEEYIHLIKEVAQLYQ-PDYIDFEYYSYKDVFEEML-----DFPNLVLSYHNFQETP--ENMMEILSELTILNPKLVKVAVMAHTEQDVLDLMNYTRGFKTLNPEQEYVTISMGKVGKVSRITADVTGSSWSFASLDEVSAPGQISLASMKKIREILDEA
4H3D Chain:B ((20-255))PKICVPIIGKNKKDIIKEAKELKDA-CLDIIEWRVDFFENVENIKEVKEVLYEL-RSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEIS-NTGLVDLIDVELFMGDEVIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIYADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKSVSAPGQISFKELNSVLNLLHK-


General information:
TITO was launched using:
RESULT:

Template: 4H3D.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 1143 1853 1.62 8.38
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain B : 0.79

3D Compatibility (PKB) : 1.62
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.79
QMean score : 0.518

(partial model without unconserved sides chains):
PDB file : Tito_4H3D.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4H3D-query.scw
PDB file : Tito_Scwrl_4H3D.pdb: