Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRDKIRLVSSAGTGYFYTTTKNKRTMPEKMEIKKFDPKIRQHVIFKEAKIK 2ELM Chain:A ((1-37)) -------GSSGSSGHLYYCSQCHYSSIT-------KNCLKRHVIQKHSNIL

General information: TITO was launched using: RESULT: Template: 2ELM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 71 -628 -8.85 -16.97 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -8.85 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.293

(partial model without unconserved sides chains): PDB file : Tito_2ELM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ELM-query.scw PDB file : Tito_Scwrl_2ELM.pdb: