Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSLYATQDEKKQAAAKAALKHLPKGGILGVGTGSTVNFLIDLLPELQ--LEAAVASSQATADRLKKLGIEVVDMNHVVSLDAYVDGADEIDRHMHMIKGGGAALTREKIVASIAKKFVCIVDDSKWVDQLGRDFPLPVEVIPMARSAVARKLVSLGGDPVYREGVVTDNGNVILDVFNLNILNAIDLEKTINNIPGVVTNGIFALNPATIAIVATNDGIEERTAQ
1M0S Chain:B ((2-218))-----NQLEMKKLAAQAALQYVKADRIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVI---


General information:
TITO was launched using:
RESULT:

Template: 1M0S.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 1296 680 0.52 3.16
target 2D structure prediction score : 0.60
Monomeric hydrophicity matching model chain B : 0.86

3D Compatibility (PKB) : 0.52
2D Compatibility (Sec. Struct. Predict.) : 0.60
1D Compatibility (Hydrophobicity) : 0.86
QMean score : 0.548

(partial model without unconserved sides chains):
PDB file : Tito_1M0S.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1M0S-query.scw
PDB file : Tito_Scwrl_1M0S.pdb: