Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVKKLTREEVFNKVAKIISNHFEIDTDKVTDELNIKDDLKADSISIMEFVLELEDEFGTEISDEDAEQIETVGGAVDYISSHLK 4IHF Chain:L ((9-77)) -------------RVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYING---

General information: TITO was launched using: RESULT: Template: 4IHF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 221 -39397 -178.26 -570.96 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain L : 0.84 3D Compatibility (PKB) : -178.26 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.631

(partial model without unconserved sides chains): PDB file : Tito_4IHF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IHF-query.scw PDB file : Tito_Scwrl_4IHF.pdb: