Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWYQGEMSR-KEAEGLLE----KDGDFLVRKSTTNPGSFVLTGMHNGQAKHLLL-VDPEGTIRTKDRVFDSISHLINHH
2HDX Chain:C ((11-87))WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETRRGECVLTFNFQGKAKHLRLSLNAAGQCRVQHLHFQSIFDMLEH-


General information:
TITO was launched using:
RESULT:

Template: 2HDX.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 238 7317 30.74 103.06
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain C : 0.78

3D Compatibility (PKB) : 30.74
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.78
QMean score : 0.836

(partial model without unconserved sides chains):
PDB file : Tito_2HDX.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2HDX-query.scw
PDB file : Tito_Scwrl_2HDX.pdb: