Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNLELDQDGHLVDYTIWNPEVAQELAKSLDLELTDWHFEVLAAVRQFYQQFGHSPATRPLIKFLM-KTVSPDINNAVLQQKFNTGLVARHLSRLAGIPKPANCL 3K2Z Chain:B ((2-53)) -------------------------------DLTERQRKVLLFIEEFIEKNGYPPSVREIARRFRITP---RGALLHLIALEKKGY------------------

General information: TITO was launched using: RESULT: Template: 3K2Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 123 -12286 -99.88 -240.89 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain B : 0.58 3D Compatibility (PKB) : -99.88 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.697

(partial model without unconserved sides chains): PDB file : Tito_3K2Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3K2Z-query.scw PDB file : Tito_Scwrl_3K2Z.pdb: