Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATSPKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTV-NEEGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSNNTASYAA 2GUJ Chain:B ((57-139)) -------------------------------------------------------GTGTATFYKVTSKFVLLMMDYVKKGSD-PYFTLQAVLDDQSSGRGTERVTLYDVNFDSAKIASLD-----EEEVPFTFEDFDV------------------------------

General information: TITO was launched using: RESULT: Template: 2GUJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 236 -8275 -35.06 -108.88 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain B : 0.60 3D Compatibility (PKB) : -35.06 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.282

(partial model without unconserved sides chains): PDB file : Tito_2GUJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2GUJ-query.scw PDB file : Tito_Scwrl_2GUJ.pdb: