Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVKKLTREEVFNKVAKIISNHFEIDTDKVTDELNIKDDLKADSISIMEFVLELEDEFGTEISDEDAEQIETVGGAVDYISSHLK 4IHF Chain:I ((9-77)) -------------RVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYING---

General information: TITO was launched using: RESULT: Template: 4IHF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 245 -38230 -156.04 -554.06 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain I : 0.84 3D Compatibility (PKB) : -156.04 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.638

(partial model without unconserved sides chains): PDB file : Tito_4IHF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IHF-query.scw PDB file : Tito_Scwrl_4IHF.pdb: