Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNQNDKRKMMKGLYIVPLAAATLLLGACATTVKPTYVSPTQYQSLSCQQLQSEYNRIQQYIDNGVQTPKSTGMGVGLGLGGGWGRGGWGFGPSISVNMGQSSSTKNTELSRVLGQQEAIVQAAQFKNCPIIVRKKTN 5KC1 Chain:A ((123-151)) -----------------------------------------LSPINDPLLMSILNRLQFNLNNDIQLKTE-------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5KC1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 13 -2785 -214.19 -96.02 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -214.19 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.638

(partial model without unconserved sides chains): PDB file : Tito_5KC1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5KC1-query.scw PDB file : Tito_Scwrl_5KC1.pdb: